AbLang - GitLite

KO | EN

gitlite — search

#python #typescript #android #machine-learning #linux #nodejs #java #windows #awesome #kubernetes #vue #pytorch #ios #openai

AbLang

(★ 169)

AbLang: A language model for antibodies

파일 탐색기

최종 버전 다운로드 (.zip)

- - publish-to-pypi.yml
  - release.yml
- __init__.py
- embedding.py
- encoderblocks.py
- extra_fns.py
- fairseq_mha.py
- model.py
- pretrained.py
- tokenizers.py
- example-ablang-usecases.ipynb
LICENSE
README.md
setup.py

# 설치 가이드

1. 코드 내려받기

git clone https://github.com/oxpig/AbLang

깃허브에서 프로젝트 코드 전체를 내 컴퓨터로 내려받습니다.

cd AbLang

방금 내려받은 프로젝트 폴더 안으로 이동합니다.

2. 공식 설치 스크립트

쉬움 추천

사전 준비물

Python 3 pip 명령어를 쓰려면 Python이 필요합니다.

pip install ablang

PyPI에 배포된 패키지를 바로 설치합니다. 소스 클론이 필요 없습니다.

pip install -U git+https://github.com/oxpig/AbLang.git

PyPI에 배포된 패키지를 바로 설치합니다. 소스 클론이 필요 없습니다.

✅ 설치 후 새 터미널을 열고, 프로그램의 버전 확인 명령(예: --version)으로 정상 설치됐는지 확인하세요.

이 레포의 README에 적힌 실제 명령어를 그대로 가져왔습니다.

3. Python

쉬움

사전 준비물

Git GitHub에서 프로젝트 코드를 내려받으려면 필요합니다.
Python 3 설치 시 'Add Python to PATH' 옵션을 꼭 체크하세요 (Windows).

pip install ablang

PyPI에 배포된 패키지를 바로 설치합니다. 소스 클론이 필요 없습니다.

pip install -U git+https://github.com/oxpig/AbLang.git

PyPI에 배포된 패키지를 바로 설치합니다. 소스 클론이 필요 없습니다.

✅ 에러 메시지 없이 실행되고 터미널에 안내 문구가 출력되면 정상입니다.

이 레포의 README에 적힌 실제 명령어를 그대로 가져왔습니다.

// repository documentation

Was this content helpful?

★ 0 (0 ratings)

---

<div align="center">    
 
# AbLang: A language model for antibodies

[![DOI:10.1101/2022.01.20.477061](http://img.shields.io/badge/DOI-10.1101/2022.01.20.477061-B31B1B.svg)](https://doi.org/10.1093/bioadv/vbac046)

</div>

**Motivation:** General protein language models have been shown to summarize the semantics of protein sequences into representations that are useful for state-of-the-art predictive methods. However, for antibody specific problems, such as restoring residues lost due to sequencing errors, a model trained solely on antibodies may be more powerful. Antibodies are one of the few protein types where the volume of sequence data needed for such language models is available, e.g. in the Observed Antibody Space (OAS) database.

**Results:** Here, we introduce AbLang, a language model trained on the antibody sequences in the OAS database. We demonstrate the power of AbLang by using it to restore missing residues in antibody sequence data, a key issue with B-cell receptor repertoire sequencing, e.g. over 40% of OAS sequences are missing the first 15 amino acids. AbLang restores the missing residues of antibody sequences better than using IMGT germlines or the general protein language model ESM-1b. Further, AbLang does not require knowledge of the germline of the antibody and is seven times faster than ESM-1b.

**Availability and implementation:** AbLang is a python package available at https://github.com/oxpig/AbLang.

-----------

# Install AbLang

AbLang is freely available and can be installed with pip.

~~~.sh
    pip install ablang
~~~

or directly from github.

~~~.sh
    pip install -U git+https://github.com/oxpig/AbLang.git
~~~

**NB:** If you use the argument "align=True", you need to manually install a version of [ANARCI](https://github.com/oxpig/ANARCI) in the same environment. ANARCI can also be installed using bioconda; however, this version is maintained by a third party.

~~~.sh
    conda install -c bioconda anarci
~~~

----------

# AbLang use cases

**A Jupyter notebook** showing the different use cases of AbLang and its building blocks can be found [here](https://github.com/TobiasHeOl/AbLang/tree/main/examples).

Currently, AbLang can be used to generate three different representations/encodings for antibody sequences.

1. **Res-codings:** These encodings are 768 values for each residue, useful for residue specific predictions.

2. **Seq-codings:** These encodings are 768 values for each sequence, useful for sequence specific predictions. The same length of encodings for each sequence, means these encodings also removes the need to align antibody sequences.

3. **Res-likelihoods:** These encodings are the likelihoods of each amino acid at each position in a given antibody sequence, useful for exploring possible mutations. The order of amino acids follows the ablang vocabulary.

These representations can be used for a plethora of antibody design applications. As an example, we have used the res-likelihoods from AbLang to restore missing residues in antibody sequences due either to sequencing errors, such as ambiguous bases, or the limitations of the sequencing techniques used.

## Antibody sequence restoration

Restoration of antibody sequences can be done using the "restore" mode as seen below.

```{r, engine='python', count_lines}
import ablang

heavy_ablang = ablang.pretrained("heavy") # Use "light" if you are working with light chains
heavy_ablang.freeze()

seqs = [
    'EV*LVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
    '*************PGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNK*YADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTL*****',
]

heavy_ablang(seqs, mode='restore')

```

The output of the above is seen below.

```console
array(['EVQLVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
       'QVQLVESGGGVVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS'],
      dtype='<U121')
```
-----

For restoration of an unknown number of missing residues at the ends of antibody sequences, the "align" parameter can be set to True.

```{r, engine='python', count_lines}
seqs = [
    'EV*LVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
    'PGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNK*YADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTL',
]

heavy_ablang(seqs, mode='restore', align=True)

```

The output of the above is seen below.

```console
array(['EVQLVESGPGLVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS',
       'QVQLVESGGGVVQPGKSLRLSCVASGFTFSGYGMHWVRQAPGKGLEWIALIIYDESNKYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVFYCAKVKFYDPTAPNDYWGQGTLVTVSS'],
      dtype='<U121')
```
-----

### Citation   
```
@article{Olsen2022,
  title={AbLang: An antibody language model for completing antibody sequences},
  author={Tobias H. Olsen, Iain H. Moal and Charlotte M. Deane},
  journal={bioRxiv},
  doi={https://doi.org/10.1101/2022.01.20.477061},
  year={2022}
}
```